PDB entry 1qy7

View 1qy7 on RCSB PDB site
Description: The structure of the PII protein from the cyanobacteria Synechococcus sp. PCC 7942
Class: Transcription
Keywords: alpha/beta, Transcription
Deposited on 2003-09-09, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • engineered (48)
    Domains in SCOPe 2.07: d1qy7a_
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • engineered (48)
    Domains in SCOPe 2.07: d1qy7b_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3F4 (0-111)
      • engineered (48)
    Domains in SCOPe 2.07: d1qy7c_
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7A (A:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7B (B:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qy7C (C:)
    mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgaeytveflqklk
    leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai