PDB entry 1qxs

View 1qxs on RCSB PDB site
Description: crystal structure of trypanosoma cruzi glyceraldehyde-3- phosphate dehydrogenase complexed with an analogue of 1,3- bisphospho-d- glyceric acid
Deposited on 2003-09-08, released 2004-05-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsA (A:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsB (B:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsC (C:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qxsD (D:)
    mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
    yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
    eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnascttnclapivhvlvk
    egfgvqtglmttihsytatqktvdgvsvkdwrggraaavniipsttgaakavgmvipstq
    gkltgmsfrvptpdvsvvdltftaardtsiqeidaalkrasktymkgilgytdeelvsad
    findnrssiydskatlqnnlpkerrffkivswydnewgyshrvvdlvrhmaskdrsarl