PDB entry 1qxk

View 1qxk on RCSB PDB site
Description: Monoacid-Based, Cell Permeable, Selective Inhibitors of Protein Tyrosine Phosphatase 1B
Class: hydrolase
Keywords: Protein Tyrosine Phosphatase 1B, PTP1B Monoacid-Based and Cell Permeable, HYDROLASE
Deposited on 2003-09-08, released 2003-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1 OR PTP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qxka_
  • Heterogens: 429, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qxkA (A:)
    memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
    pppehipppprppkrilephn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qxkA (A:)
    emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgd