PDB entry 1qwe

View 1qwe on RCSB PDB site
Description: c-src sh3 domain complexed with ligand app12
Class: complex (signal transduction/peptide)
Keywords: src sh3 domain, class II ligand complex
Deposited on 1995-11-09, released 1996-03-08
The last revision prior to the SCOP 1.73 freeze date was dated 1996-03-08, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tyrosine-protein kinase transforming protein Src
  Species: Avian sarcoma virus
  Gene: CHICKEN
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00525 (Start-63)
  Domains in SCOP 1.73: d1qwea_
• Chain 'B':
  Compound: ala-pro-pro-leu-pro-pro-arg-asn-arg-pro-arg-leu
  

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1qweA (A:)
  gshmggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
  vaps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1qweA (A:)
  tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps
  

  
  
• Chain 'B':
  No sequence available.