PDB entry 1qw8

View 1qw8 on RCSB PDB site
Description: Crystal structure of a family 51 alpha-L-arabinofuranosidase in complex with Ara-alpha(1,3)-Xyl
Class: hydrolase
Keywords: Hydrolase
Deposited on 2003-09-01, released 2003-10-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-l-arabinofuranosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ABFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XBQ3
      • engineered (174)
    Domains in SCOPe 2.02: d1qw8a1, d1qw8a2
  • Chain 'B':
    Compound: alpha-l-arabinofuranosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: ABFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XBQ3
      • engineered (174)
    Domains in SCOPe 2.02: d1qw8b1, d1qw8b2
  • Heterogens: KHO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qw8A (A:)
    matkkatmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielv
    kelqvpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvg
    aevnmavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpw
    qighktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdy
    islhqyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyh
    sneadkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapim
    tekngpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekee
    vtifavnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaql
    sdrkvsatlpklswnvirlgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qw8A (A:)
    katmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelq
    vpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevn
    mavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqigh
    ktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislh
    qyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsnea
    dkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekn
    gpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekeevtif
    avnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrk
    vsatlpklswnvirlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qw8B (B:)
    matkkatmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielv
    kelqvpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvg
    aevnmavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpw
    qighktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdy
    islhqyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyh
    sneadkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapim
    tekngpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekee
    vtifavnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaql
    sdrkvsatlpklswnvirlgkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qw8B (B:)
    katmiiekdfkiaeidkriygsfiehlgravyggiyepghpqadengfrqdvielvkelq
    vpiirypggnfvsgynwedgvgpkeqrprrldlawksvetneiglnefmdwakmvgaevn
    mavnlgtrgidaarnlveycnhpsgsyysdlriahgykephkiktwclgnamdgpwqigh
    ktaveygriaceaakvmkwvdptielvvcgssnrnmptfaeweatvldhtydhvdyislh
    qyygnrdndtanylalslemddfirsvvaiadyvkakkrskktihlsfdewnvwyhsnea
    dkliepwtvappllediynfedallvgcmlitlmkhadrvkiaclaqlvnviapimtekn
    gpawkqtiyypfmhasvygrgvalhpvisspkydskdftdvpylesiavyneekeevtif
    avnrdmedalllecdvrsfedyrviehivlehdnvkqtnsaqsspvvphrngdaqlsdrk
    vsatlpklswnvirlgk