PDB entry 1qw2

View 1qw2 on RCSB PDB site
Description: Crystal Structure of a Protein of Unknown Function TA1206 from Thermoplasma acidophilum
Class: structural genomics, unknown function
Keywords: structural genomics, Beta/Alpha, Antiparallel beta sandwich, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-08-30, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TA1206
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA1206
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HIX0 (6-100)
      • cloning artifact (0-5)
      • modified residue (7)
      • modified residue (42)
      • modified residue (48)
      • modified residue (62)
      • modified residue (70)
      • cloning artifact (101)
    Domains in SCOPe 2.07: d1qw2a1, d1qw2a2, d1qw2a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qw2A (A:)
    nyfqghmmqidsieiggkvyqffksdlgnapllfikgskgyamcgylnmetsnkvgdiav
    rvmgvktlddmlsakvveasqeaqkvginpgdvlrnvidklg