PDB entry 1qva

View 1qva on RCSB PDB site
Description: yeast initiation factor 4a n-terminal domain
Deposited on 1999-07-07, released 1999-12-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-02, with a file datestamp of 1999-12-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qvaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qvaA (A:)
    qiqtnyqkvvykfddmeldeqllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilv