PDB entry 1quw

View 1quw on RCSB PDB site
Description: solution structure of the thioredoxin from bacillus acidocaldarius
Deposited on 1999-07-02, released 2000-01-26
The last revision prior to the SCOP 1.67 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1quwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1quwA (A:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq