PDB entry 1quf

View 1quf on RCSB PDB site
Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, nadp, fad, thylakoid membrane, hycobilisome, fnr, nadp+ reductase
Deposited on 1996-09-07, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp+ reductase
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • conflict (246)
      • conflict (254)
    Domains in SCOPe 2.07: d1qufa1, d1qufa2
  • Heterogens: FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qufA (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qufA (A:)
    advpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgv
    dkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepg
    sevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfs
    wlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadql
    wqliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety