PDB entry 1qua

View 1qua on RCSB PDB site
Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution
Class: toxin
Keywords: metalloprotease, hemorrhagic toxin, snake venom proteinase, agkistrodon acutus, toxin
Deposited on 1999-06-30, released 2000-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acutolysin-c
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1quaa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1quaA (A:)
    papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
    adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
    svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
    hdyqsfltihkpqclln