PDB entry 1qtb

View 1qtb on RCSB PDB site
Description: the introduction of strain and its effects on the structure and stability of t4 lysozyme
Class: hydrolase
Keywords: strain, stability, mutant, t4 lysozyme, hydrolase
Deposited on 1999-06-26, released 1999-07-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-161)
      • engineered (41)
      • engineered (53)
      • engineered (96)
    Domains in SCOPe 2.08: d1qtba_
  • Heterogens: HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qtbA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnavkseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk