PDB entry 1qt9

View 1qt9 on RCSB PDB site
Description: oxidized [2fe-2s] ferredoxin from anabaena pcc7119
Class: electron transport
Keywords: oxidized ferredoxin, electron transport
Deposited on 1999-07-01, released 1999-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.16
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qt9a_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qt9A (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly