PDB entry 1qsz

View 1qsz on RCSB PDB site
Description: the vegf-binding domain of flt-1 (minimized mean)
Class: hormone/growth factor receptor
Keywords: immunoglobulin-like domain, I-set, vegf receptor
Deposited on 1999-06-24, released 1999-11-10
The last revision prior to the SCOP 1.75 freeze date was dated 1999-11-10, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vascular endothelial growth factor receptor 1
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17948 (0-100)
  Domains in SCOP 1.75: d1qsza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qszA (A:)
  sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
  rkgfiisnatykeiglltceatvnghlyktnylthrqtnti