PDB entry 1qsn

View 1qsn on RCSB PDB site
Description: crystal structure of tetrahymena gcn5 with bound coenzyme a and histone h3 peptide
Class: transferase
Keywords: histone acetyltransferase, gcn5-related n-acetyltransferase, coa-binding protein, ternary complex
Deposited on 1999-06-22, released 1999-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tgcn5 histone acetyl transferase
    Species: Tetrahymena thermophila [TaxId:5911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27198 (0-160)
      • conflict (41)
    Domains in SCOPe 2.08: d1qsna1, d1qsna2
  • Chain 'B':
    Compound: histone h3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qsnA (A:)
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

  • Chain 'B':
    No sequence available.