PDB entry 1qr5

View 1qr5 on RCSB PDB site
Description: solution structure of histidine containing protein (hpr) from staphylococcus carnosus
Deposited on 1999-05-19, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1qr5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qr5A (A:)
  meqqsytiidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
  itiyadgsdeadaiqaitdvlskeglte