PDB entry 1qr5

View 1qr5 on RCSB PDB site
Description: solution structure of histidine containing protein (hpr) from staphylococcus carnosus
Class: signaling protein
Keywords: phosphotransferase, signaling protein
Deposited on 1999-05-19, released 2000-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein HPr
  Species: Staphylococcus carnosus [TaxId:1281]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23534 (0-87)
  Domains in SCOPe 2.08: d1qr5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qr5A (A:)
  meqqsytiidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
  itiyadgsdeadaiqaitdvlskeglte