PDB entry 1qqy

View 1qqy on RCSB PDB site
Description: x-ray crystal structure analysis of canine milk lysozyme (apo-type)
Class: hydrolase
Keywords: apo-type protein, calcium binding lysozyme, enzyme
Deposited on 1999-06-09, released 2000-06-09
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Canis familiaris
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81708 (0-129)
      • initial methionine (0)
    Domains in SCOP 1.73: d1qqya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqyA (A:)
    mkifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl