PDB entry 1qqy

View 1qqy on RCSB PDB site
Description: x-ray crystal structure analysis of canine milk lysozyme (apo-type)
Deposited on 1999-06-09, released 2000-06-09
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qqya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qqyA (A:)
    mkifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl