PDB entry 1qqj

View 1qqj on RCSB PDB site
Description: crystal structure of mouse fumarylacetoacetate hydrolase refined at 1.55 angstrom resolution
Class: hydrolase
Keywords: mixed beta-sandwich roll, hydrolase
Deposited on 1999-06-07, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.183
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qqja1, d1qqja2
  • Chain 'B':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qqjb1, d1qqjb2
  • Heterogens: CA, ACT, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqjA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqjA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qqjB (B:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqjB (B:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal