PDB entry 1qqd

View 1qqd on RCSB PDB site
Description: crystal structure of hla-cw4, a ligand for the kir2d natural killer cell inhibitory receptor
Class: immune system
Keywords: immunoglobulin (ig)-like domain, alpha helix, beta sheet, immune system
Deposited on 1999-06-03, released 1999-12-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histocompatibility leukocyte antigen (hla)-cw4 (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1qqda1, d1qqda2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61769 (0-98)
      • conflict (0)
      • conflict (58)
    Domains in SCOPe 2.02: d1qqdb_
  • Chain 'C':
    Compound: hla-cw4 specific peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1QQD (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qqdA (A:)
shsmryfstsvswpgrgeprfiavgyvddtqfvrfdsdaasprgeprepwveqegpeywd
retqkykrqaqadrvnlrklrgyynqsedgshtlqrmfgcdlgpdgrllrgynqfaydgk
dyialnedlrswtaadtaaqitqrkweaareaeqrraylegtcvewlrrylengketlqr
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrw

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qqdB (B:)
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfsgd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd

  • Chain 'C':
    No sequence available.