PDB entry 1qqc

View 1qqc on RCSB PDB site
Description: crystal structure of an archaebacterial dna polymerase d.tok
Deposited on 1999-06-02, released 1999-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-14, with a file datestamp of 1999-10-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qqcA (A:)
    mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
    ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
    lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy
    vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe
    sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayerndvapnkpderelarrtesyaggyvkepekglwenivyldykslypsiiithnvsp
    dtlnregcreydvapqvghrfckdfpgfipsllgdlleerqkvkkkmkatvdpierklld
    yrqraikilansyygyyayanarwycrecaesvtawgrqyiettmreieekfgfkvlyad
    tdgffatipgadaetvknkakeflnyinprlpglleleyegfyrrgffvtkkkyavidee
    dkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevteklsrhevppekl
    viyeqitrdlrsyratgphvavakrlaargikirpgtvisyivlkgpgrvgdraipfdef
    dpakhrydaeyyienqvlpaverilrafgyrkedlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qqcA (A:)
    mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
    ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
    lidrglipmegdeelrmlafdietlyhegeefgegpilmisyadeegarvitwknidlpy
    vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpkekvyaeeiarawe
    sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrsstgnlvewfllrk
    ayerndvapnkpderelarrtesyakepekglwenivyldykslypsiiithnvspdtln
    regcreydvapqvghrfckdfpgfipsllgdlleerqkvkkkmkatvdpierklldyrqr
    aikilansyygyyayanarwycrecaesvtawgrqyiettmreieekfgfkvlyadtdgf
    fatipgadaetvknkakeflnyinprlpglleleyegfyrrgffvtkkkyavideedkit
    trgleivrrdwseiaketqarvleailkhgdveeavrivkevteklsrhevppeklviye
    gphvavakrlaargikirpgtvisyivlkgpgrvgdraipfdefdpakhrydaeyyienq
    vlpaverilrafgyrkedlr