PDB entry 1qq8

View 1qq8 on RCSB PDB site
Description: x-ray crystal structure of human heme oxygenase-1 (ho-1) in complex with its substrate heme
Deposited on 1999-06-11, released 1999-09-01
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1qq8a_
  • Chain 'B':
    Domains in SCOP 1.61: d1qq8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qq8A (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qq8B (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth