PDB entry 1qp1

View 1qp1 on RCSB PDB site
Description: kappa variable light chain
Class: immune system
Keywords: beta sandwich, double spiral
Deposited on 1999-05-30, released 1999-06-17
The last revision prior to the SCOP 1.73 freeze date was dated 1999-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones kappa I antibody bre (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-106)
    Domains in SCOP 1.73: d1qp1a_
  • Chain 'B':
    Compound: bence-jones kappa I antibody bre (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-106)
    Domains in SCOP 1.73: d1qp1b_
  • Chain 'C':
    Compound: bence-jones kappa I antibody bre (light chain)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PIR I39154 (0-106)
    Domains in SCOP 1.73: d1qp1c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qp1A (A:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qp1B (B:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qp1C (C:)
diqmtqspsslsasvgdrvtitcqasqdisdyliwyqqklgkapnlliydastletgvps
rfsgsgsgteytftisslqpediatyycqqyddlpytfgqgtkveik