PDB entry 1qoz

View 1qoz on RCSB PDB site
Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei
Deposited on 1999-11-25, released 2000-11-24
The last revision prior to the SCOP 1.63 freeze date was dated 2001-03-20, with a file datestamp of 2001-03-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qoza_
  • Chain 'B':
    Domains in SCOP 1.63: d1qozb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qozA (A:)
    ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
    vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
    avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
    gndpnvhqgygqeygqqalafinsqls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qozB (B:)
    ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
    vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
    avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
    gndpnvhqgygqeygqqalafinsql