PDB entry 1qok

View 1qok on RCSB PDB site
Description: mfe-23 an anti-carcinoembryonic antigen single-chain fv antibody
Deposited on 1999-11-11, released 2000-11-10
The last revision prior to the SCOP 1.59 freeze date was dated 2000-11-10, with a file datestamp of 2000-11-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qokA (A:)
    qvklqqsgaelvrsgtsvklsctasgfnikdsymhwlrqgpeqglewigwidpengdtey
    apkfqgkatfttdtssntaylqlssltsedtavyycnegtptgpyyfdywgqgttvtvss
    ggggsggggsggggsenvltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspkl
    wiystsnlasgvparfsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklel
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qokA (A:)
    qvklqqsgaelvrsgtsvklsctasgfnikdsymhwlrqgpeqglewigwidpengdtey
    apkfqgkatfttdtssntaylqlssltsedtavyycnegtptgpyyfdywgqgttvtvss
    genvltqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklwiystsnlasgvpa
    rfsgsgsgtsysltisrmeaedaatyycqqrssypltfgagtklelk