PDB entry 1qod

View 1qod on RCSB PDB site
Description: ferredoxin mutation e94k
Class: electron transport
Keywords: electron transport, iron-sulfur, ferredoxin
Deposited on 1997-08-14, released 1998-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 1998-01-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: ANABAENA SP.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06543 (0-97)
      • conflict (60)
      • engineered (93)
    Domains in SCOPe 2.06: d1qoda_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qodA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    edqsfldddqieagyvltcvayptsdvviqthkkedly