PDB entry 1qob

View 1qob on RCSB PDB site
Description: ferredoxin mutation d62k
Class: electron transport
Keywords: electron transport, iron-sulfur, ferredoxin
Deposited on 1997-08-14, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.178
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3C7 (0-97)
      • engineered (61)
    Domains in SCOPe 2.07: d1qoba_
  • Chain 'B':
    Compound: ferredoxin
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A3C7 (0-97)
      • engineered (61)
    Domains in SCOPe 2.07: d1qobb_
  • Heterogens: SO4, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qobA (A:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    skqsfldddqieagyvltcvayptsdvviqthkeedly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qobB (B:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    skqsfldddqieagyvltcvayptsdvviqthkeedly