PDB entry 1qo9

View 1qo9 on RCSB PDB site
Description: native acetylcholinesterase from drosophila melanogaster
Class: hydrolase
Keywords: hydrolase (serine esterase), hydrolase, serine esterase, synapse, membrane, nerve, muscle, signal, neurotransmitter degradation, glycoprotein, gpi-anchor, alternative splicing
Deposited on 1999-11-08, released 2000-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.258
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qo9a_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qo9A (A:)
    vidrlvvqtssgpvrgrsvtvqgrevhvytgipyakppvedlrfrkpvpaepwhgvldat
    glsatcvqeryeyfpgfsgeeiwnpntnvsedclyinvwapakarlrhgrganggehpng
    kqadtdhlihngnpqnttnglpiliwiygggfmtgsatldiynadimaavgnvivasfqy
    rvgafgflhlapempsefaeeapgnvglwdqalairwlkdnahafggnpewmtlfgesag
    sssvnaqlmspvtrglvkrgmmqsgtmnapwshmtsekaveigkalindcncnasmlktn
    pahvmscmrsvdaktisvqqwnsysgilsfpsaptidgaflpadpmtlmktadlkdydil
    mgnvrdegtyfllydfidyfdkddatalprdkyleimnnifgkatqaereaiifqytswe
    gnpgyqnqqqigravgdhfftcptneyaqalaergasvhyyyfthrtstslwgewmgvlh
    gdeieyffgqplnnslqyrpverelgkrmlsaviefaktgnpaqdgeewpnfskedpvyy
    ifstddkieklargplaarcsfwndylpkvrswagtcdgdsgsas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qo9A (A:)
    drlvvqtssgpvrgrsvtvqgrevhvytgipyakppvedlrfrkpvpaepwhgvldatgl
    satcvqeryeyfpgfsgeeiwnpntnvsedclyinvwapaknttnglpiliwiygggfmt
    gsatldiynadimaavgnvivasfqyrvgafgflhlapempsefaeeapgnvglwdqala
    irwlkdnahafggnpewmtlfgesagsssvnaqlmspvtrglvkrgmmqsgtmnapwshm
    tsekaveigkalindcncnasmlktnpahvmscmrsvdaktisvqqwnsysgilsfpsap
    tidgaflpadpmtlmktadlkdydilmgnvrdegtyfllydfidyfdkddatalprdkyl
    eimnnifgkatqaereaiifqytswegnpgyqnqqqigravgdhfftcptneyaqalaer
    gasvhyyyfthrtstslwgewmgvlhgdeieyffgqplnnslqyrpverelgkrmlsavi
    efaktgnpaqdgeewpnfskedpvyyifstddkieklargplaarcsfwndylpkvrswa