PDB entry 1qo0

View 1qo0 on RCSB PDB site
Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the positive regulator amir.
Class: binding protein
Keywords: binding protein, gene regulator, receptor
Deposited on 1999-10-26, released 1999-12-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amic
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27017 (6-End)
      • conflict (26-27)
    Domains in SCOPe 2.02: d1qo0a_
  • Chain 'B':
    Compound: amic
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27017 (6-379)
      • conflict (26-27)
    Domains in SCOPe 2.02: d1qo0b_
  • Chain 'D':
    Compound: amir
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10932 (1-End)
      • conflict (63)
    Domains in SCOPe 2.02: d1qo0d_
  • Chain 'E':
    Compound: amir
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10932 (1-194)
      • conflict (63)
    Domains in SCOPe 2.02: d1qo0e_
  • Heterogens: BMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qo0A (A:)
    mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
    dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyg
    gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
    psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
    kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
    qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
    irpdpyvvvhnlddwsasmgggplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qo0A (A:)
    rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
    aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
    nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
    qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
    aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
    rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
    vvvhnlddwsasm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qo0B (B:)
    mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
    dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyg
    gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
    psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
    kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
    qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
    irpdpyvvvhnlddwsasmgggplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qo0B (B:)
    rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
    aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
    nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
    qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
    aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
    rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
    vvvhnlddwsasmg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qo0D (D:)
    msansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsi
    fqnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlv
    sarriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrre
    pilkiaqellgnepsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qo0D (D:)
    sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
    qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
    arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
    ilkiaqell
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qo0E (E:)
    msansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsi
    fqnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlv
    sarriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrre
    pilkiaqellgnepsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qo0E (E:)
    sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
    qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
    arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
    ilkiaqellgneps