PDB entry 1qnz

View 1qnz on RCSB PDB site
Description: NMR structure of the 0.5b anti-HIV antibody complex with the gp120 V3 peptide
Class: immune system
Keywords: antibody, v3 peptide, binding site, immune system
Deposited on 1999-10-26, released 2000-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 0.5b antibody (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QNZ (0-118)
      • conflict (24)
    Domains in SCOPe 2.05: d1qnzh_
  • Chain 'L':
    Compound: 0.5b antibody (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01665 (0-110)
      • conflict (71)
      • expression tag (111)
    Domains in SCOPe 2.05: d1qnzl_
  • Chain 'P':
    Compound: gp120
    Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qnzH (H:)
qvqlqqsgaelvkpgasvkmsckasgytfttypiewmkqnhgkslewignfhpysddtny
nekfkgkakltvekssstvylefsrltsddsavyycaihygsayamdywgqgtsvtvss

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qnzL (L:)
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr

  • Chain 'P':
    No sequence available.