PDB entry 1qnz

View 1qnz on RCSB PDB site
Description: nmr structure of the 0.5b anti-hiv antibody complex with the gp120 v3 peptide
Deposited on 1999-10-26, released 2000-06-03
The last revision prior to the SCOP 1.65 freeze date was dated 2001-10-05, with a file datestamp of 2001-10-05.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.65: d1qnzh_
  • Chain 'L':
    Domains in SCOP 1.65: d1qnzl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qnzH (H:)
qvqlqqsgaelvkpgasvkmsckasgytfttypiewmkqnhgkslewignfhpysddtny
nekfkgkakltvekssstvylefsrltsddsavyycaihygsayamdywgqgtsvtvss

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qnzL (L:)
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr