PDB entry 1qnl

View 1qnl on RCSB PDB site
Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide
Class: transferase
Keywords: binding protein, gene regulator, receptor, kinase, repressor, transferase
Deposited on 1999-10-19, released 1999-12-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.269
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aliphatic amidase expression-regulating protein
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27017 (7-374)
      • conflict (26-27)
    Domains in SCOPe 2.02: d1qnla_
  • Heterogens: BMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnlA (A:)
    mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
    dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcypnpyegfeyspnivyg
    gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
    psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
    kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
    qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
    irpdpyvvvhnlddwsasmgggplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnlA (A:)
    pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
    edfirnrgvrflvgcymshtrkavmpvveradallcypnpyegfeyspnivyggpapnqn
    saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
    raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
    egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
    vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
    vvhnlddw