PDB entry 1qnl

View 1qnl on RCSB PDB site
Description: amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide
Class: binding protein
Keywords: binding protein, gene regulator, receptor
Deposited on 1999-10-19, released 1999-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.269
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amic
    Species: Pseudomonas aeruginosa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27017
      • conflict (105)
      • conflict (185)
      • conflict (262)
      • conflict (304)
      • conflict (318)
    Domains in SCOP 1.75: d1qnla_
  • Heterogens: BMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qnlA (A:)
    mgshqerpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdp
    dryrlcaedfirnrgvrflvgcymshtrkavmpvveradallcypnpyegfeyspnivyg
    gpapnqnsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiply
    psdddlqraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaeva
    kmesdvaegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraa
    qaagnwrvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspep
    irpdpyvvvhnlddwsasmgggplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qnlA (A:)
    pligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlca
    edfirnrgvrflvgcymshtrkavmpvveradallcypnpyegfeyspnivyggpapnqn
    saplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddlq
    raveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdva
    egqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnwr
    vedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpyv
    vvhnlddw