PDB entry 1qn2

View 1qn2 on RCSB PDB site
Description: cytochrome ch from methylobacterium extorquens
Deposited on 1999-10-13, released 2000-10-13
The last revision prior to the SCOP 1.63 freeze date was dated 2000-10-13, with a file datestamp of 2000-10-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.161
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qn2a_
  • Chain 'B':
    Domains in SCOP 1.63: d1qn2b_
  • Chain 'C':
    Domains in SCOP 1.63: d1qn2c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn2A (A:)
    egdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqa
    dlkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn2B (B:)
    gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
    lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qn2C (C:)
    gdaaagekafapckachnfekngvgptlkgvvgakagegadgyafsdalkksgltwdqad
    lkqwladpkkkvpgtkmvfpgisdpkkvddiiaylktk