PDB entry 1qmr

View 1qmr on RCSB PDB site
Description: birch pollen allergen bet v 1 mutant n28t, k32q, e45s, p108g
Class: allergen
Keywords: allergen, pathogenesis-related protein
Deposited on 1999-10-06, released 2000-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: BETULA VERRUCOSA [TaxId:3505]
    Gene: BET V 1 1.2801
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15494 (0-158)
      • engineered mutation (27)
      • engineered mutation (31)
      • engineered mutation (44)
      • engineered mutation (107)
      • conflict (61)
    Domains in SCOPe 2.07: d1qmra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qmrA (A:)
    gvfnyetettsvipaarlfkafildgdtlfpqvapqaissvenisgnggpgtikkisfpe
    glpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatgdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn