PDB entry 1qm9

View 1qm9 on RCSB PDB site
Description: nmr, representative structure
Deposited on 1999-09-22, released 2000-07-03
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-03, with a file datestamp of 2000-07-03.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm9A (A:)
    mgnsvllvsnlnpervtpqslfilfgvygdvqrvkilfnkkenalvqmadgnqaqlamsh
    lnghklhgkpiritlskhqnvqlpregqedqgltkdygnsplhrfkkpgsknfqnifpps
    atlhlsnippsvseedlkvlfssnggvvkgfkffqkdrkmaliqmgsveeavqalidlhn
    hdlgenhhlrvsfsksti