PDB entry 1qm8

View 1qm8 on RCSB PDB site
Description: structure of bacteriorhodopsin at 100 k
Deposited on 1999-09-22, released 2000-08-16
The last revision prior to the SCOP 1.61 freeze date was dated 2002-01-17, with a file datestamp of 2002-01-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.251
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1qm8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qm8A (A:)
    aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
    lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
    glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
    wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraif