PDB entry 1qlr

View 1qlr on RCSB PDB site
Description:
Deposited on 1999-09-11, released 2000-09-14
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-31, with a file datestamp of 2001-05-31.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qlra1, d1qlra2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qlrb1, d1qlrb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qlrc1, d1qlrc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qlrd1, d1qlrd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlrA (A:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qlrB (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlrB (B:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
    qvllptdehvvckvqhpngnkeknvplpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlrC (C:)
    eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qlrD (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
    rggkyaatsqvllpskdvmqgtdehvvckvqhpngnkeknvplpviaelppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qlrD (D:)
    evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
    pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss
    gsasaptlfplvscvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkyaats
    qvllptdehvvckvqhpngnkeknvplpv