PDB entry 1qlq

View 1qlq on RCSB PDB site
Description: bovine pancreatic trypsin inhibitor (bpti) mutant with altered binding loop sequence
Deposited on 1999-09-10, released 1999-10-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-03, with a file datestamp of 2000-02-03.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.1103
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qlqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qlqA (A:)
    rpdfcleppyagacrariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga