PDB entry 1qll

View 1qll on RCSB PDB site
Description: Piratoxin-II (Prtx-II) - a K49 PLA2 from Bothrops pirajai
Class: neurotoxin
Keywords: neurotoxin, k49 phospholipase a2 (pla2)
Deposited on 1999-09-01, released 2000-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: BOTHROPS PIRAJAI [TaxId:113192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82287 (0-120)
      • conflict (119)
    Domains in SCOPe 2.08: d1qlla_
  • Chain 'B':
    Compound: phospholipase a2
    Species: BOTHROPS PIRAJAI [TaxId:113192]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82287 (0-120)
      • conflict (119)
    Domains in SCOPe 2.08: d1qllb_
  • Heterogens: TDA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qllA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qllB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadk
c