PDB entry 1ql9

View 1ql9 on RCSB PDB site
Description: factor xa specific inhibitor in complex with rat trypsin mutant x99rt
Deposited on 1999-08-24, released 2000-08-25
The last revision prior to the SCOP 1.61 freeze date was dated 2000-08-25, with a file datestamp of 2000-08-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ql9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ql9A (A:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan