PDB entry 1qkz

View 1qkz on RCSB PDB site
Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
Deposited on 1999-08-17, released 2000-02-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-06, with a file datestamp of 2000-02-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkzA (A:)
    vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkzH (H:)
    dvklvesggglvkpgrslklscaasgftfsdyymfwvrqtpeqrlewvatisdggaytyy
    pdsvkgrftisrdnaknnlylqmnslksedtgmyycardpleyygmdywgqgtsvavssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvnvtsstwpsqsitcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qkzL (L:)
    nivmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliytvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthfptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkzL (L:)
    nivmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliytvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthfptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrne