PDB entry 1qkw

View 1qkw on RCSB PDB site
Description: alpha-spectrin src homology 3 domain, n47g mutant in the distal loop.
Deposited on 1999-08-16, released 2000-08-18
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-28, with a file datestamp of 2001-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qkwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkwA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkkld