PDB entry 1qku

View 1qku on RCSB PDB site
Description: wild type estrogen nuclear receptor ligand binding domain complexed with estradiol
Class: nuclear receptor
Keywords: AGONISM, ANTAGONISM, CRYSTAL STRUCTURE, ESTRADIOL RECEPTOR, STEROID, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 1999-08-05, released 2000-08-18
The last revision prior to the SCOP 1.75 freeze date was dated 2000-08-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.216
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: estradiol receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qkua_
  • Chain 'B':
    Compound: estradiol receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qkub_
  • Chain 'C':
    Compound: estradiol receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qkuc_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qkuA (A:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qkuB (B:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkuB (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qkuC (C:)
    skknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminw
    akrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcveg
    mveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvld
    kitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydll
    lemldahrlh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkuC (C:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
    ldahrlh