PDB entry 1qkt

View 1qkt on RCSB PDB site
Description: mutant estrogen nuclear receptor ligand binding domain complexed with estradiol
Class: nuclear receptor
Keywords: AGONISM, ANTAGONISM, CRYSTAL STRUCTURE, ESTRADIOL RECEPTOR, STEROID, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 1999-08-05, released 2000-08-18
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: estradiol receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372 (0-247)
      • engineered (77)
      • engineered (113)
      • engineered (226)
    Domains in SCOP 1.75: d1qkta_
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qktA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha