PDB entry 1qkn

View 1qkn on RCSB PDB site
Description: rat oestrogen receptor beta ligand-binding domain in complex with antagonist raloxifene
Deposited on 1999-07-27, released 2000-07-28
The last revision prior to the SCOP 1.63 freeze date was dated 2000-07-28, with a file datestamp of 2000-07-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qkna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qknA (A:)
    tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
    lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
    attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
    aksgissqqqsvrlanllmllshvrhisnkgmehllsmkcknvvpvydlllemlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qknA (A:)
    tlspeqlvltlleaeppnvlvsrpsmpfteasmmmsltkladkelvhmigwakkipgfve
    lslldqvrllescwmevlmvglmwrsidhpgklifapdlvldrdegkcvegileifdmll
    attsrfrelklqhkeylcvkamillnssmyplasanqeaessrklthllnavtdalvwvi
    aksgissqqqsvrlanllmllshvrhisnkgmehllsmkdlllemlna