PDB entry 1qji

View 1qji on RCSB PDB site
Description: structure of astacin with a transition-state analogue inhibitor
Deposited on 1999-06-24, released 2000-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-21, with a file datestamp of 2000-01-20.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qjia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjiA (A:)
    aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
    gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
    dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
    hmlqtdanqinnlytnecsl