PDB entry 1qjh

View 1qjh on RCSB PDB site
Description: protein aggregation and alzheimer's disease. crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization.
Class: ribosomal protein
Keywords: ribosomal protein, alzheimer disease, ribosomal protein s6, oligomerization
Deposited on 1999-06-24, released 2000-06-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: -1.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s6
    Species: THERMUS THERMOPHILUS, synthetic [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23370 (0-End)
      • engineered mutation (40-41)
      • engineered mutation (45-46)
    Domains in SCOPe 2.01: d1qjha_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjhA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjhA (A:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekvailglmvlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvks