PDB entry 1qjc

View 1qjc on RCSB PDB site
Description: Phosphopantetheine Adenylyltransferase from Escherichia coli in complex with 4'-phosphopantetheine
Class: coenzyme a biosynthesis
Keywords: coenzyme a biosynthesis, transferase, nucleotidyltransferase
Deposited on 1999-06-23, released 2001-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qjca_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qjcb_
  • Heterogens: SO4, PNS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qjcA (A:)
    qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
    lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
    kewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjcA (A:)
    kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
    gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
    ewsfissslvkevarhqgdvthflpenvhqalmakla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qjcB (B:)
    qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah
    lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps
    kewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qjcB (B:)
    kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
    gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
    ewsfissslvkevarhqgdvthflpenvhqalmakla