PDB entry 1qj2

View 1qj2 on RCSB PDB site
Description: co dehydrogenase from oligotropha carboxidovorans
Deposited on 1999-06-21, released 1999-08-03
The last revision prior to the SCOP 1.61 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2B (B:)
    tsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidt
    skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
    adaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdk
    egtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvv
    slisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlstts
    fardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvah
    lavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfp
    ymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisfftei
    vgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipad
    dimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewd
    vdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdid
    idtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfm
    dfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghi
    qmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2G (G:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2H (H:)
    tsaeraeklqgmgckrkrvedirftegkgnyvddvklpgmlfgdfvrsshahariksidt
    skakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryva
    adaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdk
    egtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvv
    slisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlstts
    fardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvah
    lavdgvytnkasggvayrxsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfp
    ymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisfftei
    vgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipad
    dimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewd
    vdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdid
    idtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfm
    dfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghi
    qmphdawrlwkvgeqlglhv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qj2I (I:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakar